SERPAnalytics:    Sign Up    Sign In   
Feedback     Pricing    
 thedeepdiscount.com
Title: TheDeepDiscount: Car Audio, Home Theater Electronics, DJ Equipment


Description:
We offer discount car and marine audio/video, home theater electronics, and DJ equipment including receivers, speakers, amplifiers, subwoofers, monitors, and more.

Top keywords: deep discount discount audio equipment deep discounts visonik the deep discount acoustic audio deep discount com car audio equipment car audio equipment 18 subwoofers

Approx. monthly SE traffic: 5.87K
Approx. monthly SE traffic cost equivalent: $6.71K

"thedeepdiscount.com" approximate summary search engine traffic

Traffic Est. Cost
Organic keywords 5.87K $6.71K*
Paid keywords N/A $54.82K
* — "Est. Cost" for organic traffic means amount of money the site owner would pay for such traffic if he bought it in PPC systems.




"thedeepdiscount.com" organic keywords

Top cost equivalent positions Top traffic positions Top positions
Google: 150 pages, 150 positions
  Keyword Cost Equiv. Position   Keyword Traffic Position   Keyword   Position
1. deep discount $3.75K  3  1. deep discount 2K  3  1. ma audio 1800 watt   1 
2. discount audio equipment $459.86  1  2. the deep discount 305  1  2. acoustic audio r191   1 
3. deep discounts $240.44  3  3. discount audio equipment 305  1  3. deep discount store   1 
4. visonik $179.00  8  4. visonik 197  8  4. the deep discount   1 
5. the deep discount $140.09  1  5. deepdiscount.com 197  8  5. discount audio equipment   1 
6. acoustic audio $134.90  6  6. 18 subwoofers 160  10  6. deep discount car audio   1 
7. deep discount com $121.82  3  7. deep discounts 135  3  7. deep discount audio   1 
8. car audio equipment $120.22  10  8. deep discount com 110  3  8. deep discount speakers   1 
9. car audio equipment $120.22  10  9. acoustic audio 96  6  9. discount sound equipment   1 
10. 18 subwoofers $93.04  10  10. home audio equipment 92  5  10. deep discount electronics   1 
  ... view all 150 positions >>   ... view all 150 positions >>   ... view all 150 positions >>

"thedeepdiscount.com" SEO score

SEO Parameters
IP Information
IP Address 68.178.166.74
IP Location United States US

"thedeepdiscount.com" related sites

 Investopedia.com: Welcome to Investopedia.com - Your Source for Investing Education

INVESTOPEDIA.COM. DIRECT TO INVESTOPEDIA.COM. Quote of the Day " ... If you don't understand that's going to happen, then you're not ready, you won't ...

Keywords: 

currency trading; investing; ira; premium bonds; rona; options trading; checking account; option trading; option trading; etf;

 Bizrate.com: Online shopping - Price comparisons & store ratings at BizRate

Online shopping made easy with BizRate. Comparison shop for the lowest prices, check store ratings & read product reviews before you buy.

Keywords: 

shopping; discount home theater systems; labtops; vitamins & nutrition; car cd mp3 players; kerastase; autoradio; strawberrynet; automotive tires; kerastase;

 Answers.yahoo.com: Yahoo! Answers - Home

Yahoo! Answers is a new way to find and share information. You can ask questions on any topic, get answers from real people, and share your insights and experience.

Keywords: 

yahoo answers; yahoo.fr; yahoo.es; who blocked me on msn; hotmail.fr; hotmail fr; yahoo answers; pre owned porsche boxster; ich liebe dich; peugeot 106;

 Usatoday.com: News, Travel, Weather, Entertainment, Sports, Technology, U.S. & World ...

Breaking news on weather, sports, world, science, financial, technology, ... HARD-HITTING DEBATE: Are aluminium bats good for college baseball? USA TODAY offers ...

Keywords: 

usa today; u s a today; usa today; u s a today; money; money; easy credit; usa; student loan debt; usa today;

 Blog.sounddomain.com: Car Audio, Car Stereos at SoundDomain

Car stereo and video news and views from the 12-volt experts. Live & breathe car audio!

Keywords: 

car audio; car domain; car domain; sound car; car sound; audio stereo; audio stereo; sound cars; audio for cars; sound systems for cars;

 Buy.com: Buy.com - Computers, Electronics, Digital Cameras, Books, DVDs, Music ...

Find, shop, and buy computers, laptops, books, dvd, videos, games, video games, music, sporting goods, software, electronics, digital cameras, camcorders, toys, ...

Keywords: 

laptop computer; computer notebooks; laptop; laptop computers; samsung; sony vaio; circuit city; ps3; best buy; jewelry & watches;

 Msnbc.msn.com: Breaking News, Weather, Business, Health, Entertainment, Sports, Politics, Travel, Science, Technology, Local, US & World News- msnbc.com

Msnbc.com is a leader in breaking news, video and original journalism. Stay current with daily news updates in health, entertainment, business, science, technology and sports videos.

Keywords: 

msn; news; msnbc; m s n; msn.com; msnbc; business; msnbc.com; to catch a predator; msnbc com;

 Acousticaudiotransfer.com: Audio Recording, Transfers and Restoration- Asheville, Hendersonville, NC

Music and audio recording, transfers to CD, DVD and MP3 from vinyl records, reel to reel, cassette and most media formats. Recording studio in Asheville, Hendersonville, Flat Rock, NC. 28803, 28739

Keywords: 

acoustic audio; audio music recording; accoustic audio; acustic audio; acoustic audio bass; acoustic audio direct;

 Carstereoworld.com: Discount Car Stereo Audio Warehouse Wholesale Stereo

Discount Wholesale Prices on Top Names in Car Audio

Keywords: 

car stereo; auto stereo; discount car audio; auto stereo; car stereo discounts; discount car stereos; a d s car audio; wholesale car audio; car stereo equipment; car stereo equipment;

 Caraudio.com: Car Audio at CarAudio.com

The Internet's #1 car audio resource for the beginner, or expert.

Keywords: 

car audio; audio; in car audio; audio car; car audio systems; car radio; car radio; car audio shop; alpine car audio; car audio forums;

 Epinions.com: Reviews from Epinions

Read Reviews on Digital Cameras, Cars, Books, Movies, Music and More.

Keywords: 

chase credit card; washing machines; uhaul; gps devices; computer games software; refrigerators; point and shoot digital cameras; juicers; dishwashers; pc laptops;

 Hometheaterforum.com: Home Theater Forum - Home Theater discussion, DVD, Blu-ray, and hardware reviews, and more

Home Theater Forum: a community for home theater buffs to discuss and review DVD and Blu-ray discs, players, televisions, home theater hardware, theatrical movie releases, and more

Keywords: 

home theater forum; home theater; htf; bose 123; home theatre; home theater forum; hdcd; hdcd; subwoofer test; projector screen paint;

 Sonicelectronix.com: Car Audio Stereo - Car Subwoofers - Car Amplifiers and Speakers

Lowest prices from the experts in car audio and video. Daily deals, fast and free shipping, up to $30 in free custom install kits on select car stereo receivers. Shop now!

Keywords: 

car amplifiers; car amplifiers; car subwoofers; car audio; car audio & video; car subwoofer; subwoofer; subwoofer; subwoofers; car stereo;
 1   2  3  4   next
Recently processed sites: landmarkappraisalgroup.com landmarkappraisal.org landmarkappraisalsandreviews.com landmarkappraisalservicesllc.com landmarkappraisalsllc.com

 
About  Affiliate program  Pricing  Top Keywords+    Top Sites+    Privacy Policy  Terms of Use 
Keyword:
Seen on:
Seen URL:
Position:
Clicks per Month:
Keyword avg. CPC:
Monthly Cost Equivalent (avg. cpc * clicks):



Keyword:
Keyword Avg.CPC:
Seen on:
Seen URL: N/A
Page no.:
Ads Block Position:
Ad Position: