SERPAnalytics:    Sign Up    Sign In   
Feedback     Pricing    
 yeatssociety.org
Title: Welcome to the Yeats Society


Description:


Top keywords: astrodienst yeats wb yeats jack b yeats competition poetry yeats summer school free horoscope reading free horoscope reading astrodients astrodient

Approx. monthly SE traffic: 5.15K
Approx. monthly SE traffic cost equivalent: $2.70K

"yeatssociety.org" approximate summary search engine traffic

Traffic Est. Cost
Organic keywords 5.15K $2.70K*
Paid keywords N/A N/A
* — "Est. Cost" for organic traffic means amount of money the site owner would pay for such traffic if he bought it in PPC systems.




"yeatssociety.org" organic keywords

Top cost equivalent positions Top traffic positions Top positions
Google: 10 pages, 10 positions
  Keyword Cost Equiv. Position   Keyword Traffic Position   Keyword   Position
1. astrodienst $2.28K  7  1. astrodienst 5K  7  1. yeats summer school   2 
2. yeats $282.96  14  2. yeats 132  14  2. yeats audio   2 
3. wb yeats $37.79  16  3. astrodients 86  10  3. yeats society   3 
4. jack b yeats $21.63  10  4. astrodient 71  10  4. yeats reading   3 
5. competition poetry $19.99  3  5. wb yeats 70  16  5. competition poetry   3 
6. yeats summer school $16.21  2  6. jack b yeats 39  10  6. yeats summer school 2009   3 
7. free horoscope reading $13.15  19  7. competition poetry 27  3  7. brown penny analysis   4 
8. free horoscope reading $12.35  20  8. astrodienst free horoscope 24  4  8. astrodienst free horoscope   4 
9. astrodients $4.31  10  9. yeats summer school 20  2  9. yeats summer school 2009   4 
10. astrodient $3.56  10  10. free horoscope reading 17  19  10. yeats poems online   5 

"yeatssociety.org" SEO score

SEO Parameters
IP Information
IP Address
IP Location Unknown IP ZZZ

"yeatssociety.org" related sites

 Online-literature.com: The Literature Network: Online classic literature, poems, and quotes ...

Author List. Authors. Authors. Authors. Adams, Henry. Adams, Samuel ... Fletcher, J.S. Foote, Mary Hallock. Forster, E.M. Fox Jr., John. France, Anatole ...

Keywords: 

great expectations; donne; h g wells; hg wells; kew gardens; william shakespeare; barrie; homer; 1984; great expectations;

 Craborchardreview.siuc.edu: Crab Orchard Review - SIUC Website

Literary magazine co-sponsors the Crab Orchard Award Series in Poetry, a book contest. Includes submission guidelines.

Keywords: 

poetry book; southern illinois university press; first book; literary contests; crab orchard review; award series; 1st book; competition award; poetry book contest; competition awards;

 Whois.domaintools.com: Whois lookup and Domain name search

Whois lookups for hundreds of TLDs with site details like IP location, screenshots, whois history, name server, IP History, blacklist status, SEO score, Alexa rank and more!

Keywords: 

gmail com; hotmail.com; hotmail com; btinternet.com; orkut.com; orkut.com; www facebook com; orkut login; whois domain; youtobe;

 Astrology.paranormal-or-superstitions.com: Astrology or Superstition? | A Guide to Understanding Planetary Relationships in the Horoscope

A Guide to Understanding Planetary Relationships in the Horoscope

Keywords: 

astrodients; diana garland; accurate horoscope; botmetro; accurate horoscope; super horoscopes; ganesha speak; my future horoscope; california astrology association; omi im;

 Danesfort.com: danesfort.com| Irish Search Engine|

Irish Search Engine| Search Ireland|

Keywords: 

filbanque; mbank logowanie; telenet webmail; webcrims; route finder rac; bbc market data; filbanque; rac routefinder; asb fastnet; intelligent finance login;

 Astrology.com: Astrology.com - Horoscopes, Tarot, Psychic Readings

Astrology.com provides free daily horoscopes, online tarot readings, psychic readings, Chinese astrology, Vedic Astrology, Mayan Astrology, Numerology, Feng Shui, zodiac 101, sun sign compatibility and video horoscopes by Heather your Cosmos Gal.

Keywords: 

astrology; horoscope; leo; horoscopes; astrologie; love match; horoscop; astrologie; libra; gemini;

 Newagestore.com: Tarot Reading | Free Tarot | Horoscopes | Psychic Reading

Free Tarot Reading! Explores spiritual areas & offers free tarot reading & divination oracles, many free tarot spreads, horoscopes & psychic readings.

Keywords: 

tarot; free tarot; free tarot reading; free tarot reading; new age; new age; tarot reading; newagestore; tarot psychic; tarot readings;

 Kamalkapoor.com: Free Astrology, free horoscope, indian astrology, indian horoscope, vedic astrology, vedic fortune teller, india astrology, astrology readings

Free astrology, free horoscope, indian astrology, indian horoscope, vedic astrology, india astrology, indian zodiac, Free Horoscope Readings, fortune teller, future predictions

Keywords: 

ganesh wallpaper; leo horoscope; malka; om wallpaper; babies wallpapers; baby wallpaper; free astrology predictions; free astrology predictions; taurus horoscope; kundli;

 Astrocenter.com: Free Horoscope | Daily Horoscope | Horoscopes & Astrology by Astrocenter.com

Free horoscopes: get your daily horoscope, Sagittarius horoscope, weekly horoscope, monthly horoscope, love astrology, career astrology, and more horoscopes from a trusted source.

Keywords: 

horoscope; astrocenter; astro; astrocenter; astrocenter.com; astrocenter.com; horoscopes; fortune telling; center com; free horoscope;

 Poetry-archive.com: Poetry Archive | Poems

An online collection of the world's greatest poetry.

Keywords: 

lesbia; walt whitman poems; lesbia; yeats; shakespeare poems; william blake poems; emily dickinson poems; emily dickinson poems; ts eliot poems; thanatopsis;

 Horoscope.com: Horoscope.com: Free Horoscopes, Astrology, Numerology and more...

Free daily horoscopes, weekly horoscopes, monthly horoscopes, chinese horoscopes, love astrology, compatibility and more

Keywords: 

horoscope; horoscopes; horoscop; horoscope for today; horoscope.com; horoscope com; free horoscope; free horoscope; horoscopes.com; today's horoscope;

 Houseastrology.info: House Astrology

Star Signs And House Astrology

Keywords: 

astrodient; ydf astrology;
 1   2  3  4   next
Recently processed sites: epicwaves.com epicwavestudios.com epicwealthseminars.com epicwealthstrategies.com epicwealthsystems.cashgiftingextreme.com

 
About  Affiliate program  Pricing  Top Keywords+    Top Sites+    Privacy Policy  Terms of Use 
Keyword:
Seen on:
Seen URL:
Position:
Clicks per Month:
Keyword avg. CPC:
Monthly Cost Equivalent (avg. cpc * clicks):



Keyword:
Keyword Avg.CPC:
Seen on:
Seen URL: N/A
Page no.:
Ads Block Position:
Ad Position: